Sign In | Join Free | My phrmg.org
phrmg.org
Products
Search by Category
Home > Chemicals > Daily Chemical Raw Materials >

Sermorelin Acetate Powder

1-10 Results for

sermorelin acetate powder

from 7214 Products

Safe Anabolic Steroid Articles Methenolone Acetate Powder CAS 434-05-9

China Safe Anabolic Steroid Articles Methenolone Acetate Powder CAS 434-05-9 on sale
... Anabolic Steroid Articles Methenolone Acetate Powder CAS 434-05-9 Quick Detail: Product Name: Methenolone Acetate Alias: Primobolan-depot: 1-methyl-3-oxoandrost-1-en-17-yl acetate; (5alpha, 17beta)-1-methyl-3-oxoandrost-1-en-17-yl acetate CAS No: 434......
zhuhai TianJian Chemical Co.,Ltd.

Address: Rm. 804, 1st Building, No. 101, Guofang Road, Gongbei, Zhuhai, Guangdong, China

98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building

China 98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building on sale
...98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): 98.0%min. Appearance: White powder Molecular Formula: C149H246N44O42S ......
Hangzhou Fuluo Biological Technology Co.,Ltd.

Address: 288# Xinfeng Road,Jianggan District,Hangzhou,Zhejiang,China

White color high pure Sermorelin Acetate powder with fast delivery from China

China White color high pure Sermorelin Acetate powder with fast delivery from China on sale
...Sermorelin Acetate name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-......
Chengdu YoungShe Chemical Co., Ltd

Address: 6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China 610000

Yellow Injectable Trenbolone Steroids For Muscle Gain Trenbolone Ace/Acetate Powder CAS 10161-34-9For badybuilding

China Yellow Injectable Trenbolone Steroids For Muscle Gain Trenbolone Ace/Acetate Powder CAS 10161-34-9For badybuilding on sale
...Yellow Injectable Trenbolone Steroids For Muscle Gain Trenbolone Ace/Acetate Powder CAS 10161-34-9For badybuilding Quick Details Product Name: Trenbolone acetate Synonyms: acetic acid [(8S,13S,14S,17S)-3-keto-13-methyl-2,6,7,8,14,15......
Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd

Address: 496, Zhongshan Road, Wuhan, China

Raw Muscle Growth Steroids Testosterone Acetate Test Acetate Powder CAS 1045-69-8

China Raw Muscle Growth Steroids Testosterone Acetate Test Acetate Powder CAS 1045-69-8 on sale
... Steroids Testosterone Acetate Test Acetate Powder CAS 1045-69-8 1.Quick detail: Item: Raw Material Powder Testosterone Acetate CAS No: 1045-69-8 Einecs: 213-876-6 MOQ: 10g Purity: 98% Apperance: White or off-White Crystalline Powder Original......
Wuhan Lianshangwang Technology Co.,Ltd

Address: No. 496 Qianjia Street, Wuchang District, Wuhan 430064, Hubei Province, China.

Muscle Gaining Trenbolone Acetate Powder / Finaplix H/Revalor-H CAS 10161-34-9

China Muscle Gaining Trenbolone Acetate Powder / Finaplix H/Revalor-H CAS 10161-34-9 on sale
...Trenbolone Raw Steroid Powder Trenbolone Acetate / Finaplix H/Revalor-H For Muscle Gaining CAS 10161-34-9 Abstract Trenbolone exhibits interesting stacking behavior. Combination ......
Chongqing Tingyi Biotechnology Co.,Ltd

Address: No.68, Jinyu Avenue, North New District, Chongqing, China

Sermorelin Acetate Powder

China Sermorelin Acetate Powder on sale
... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human......
Wuhan changdashun Technology Co., Ltd

Address: No.378, Wuluo Rd, Wuchang District, Wuhan,China

Powerful Anabolic Steroid Trenbolone Acetate Powder / Liquid / Sample Available

China Powerful Anabolic Steroid Trenbolone Acetate Powder / Liquid / Sample Available on sale
...Powerful Anabolic Steroid Trenbolone Acetate Powder / Liquid / Sample Available Trenbolone Acetate Information: Trenbolone Acetate is an extremely powerful anabolic steroid and is considered the single greatest anabolic steroid by ......
HongKong Blue Universal Co., Limited.

Address: UNIT 04 7/F BRIGHT WAY TOWER NO.33 MONG KOK RD , KL, HONGKONG

Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate

China Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate on sale
... Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate Appearance : White Powder Purity : 98......
Yihan Industrial Co.,Ltd.

Address: Room 301-7A,3/F,HongKong Trade Centre,161-167 DES VOEUX ROAD,CENTRAL,HK

86168-78-7 Sermorelin Acetate Bodybuilding , Anadrol Anabolic Steroid 99 Purity

China 86168-78-7 Sermorelin Acetate Bodybuilding , Anadrol Anabolic Steroid 99 Purity on sale
...99% purit Sermorelin Acetate CAS number:86168-78-7 white powder Peptide series Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-......
TOP PHARM CO.,LIMITED
Submit your sermorelin acetate powder inquiry in a minute :
*From:
Your email address is incorrect!
To:

TOP PHARM CO.,LIMITED

Products: 86168-78-7 Sermorelin Acetate Bodybuilding , Anadrol Anabolic Steroid 99 Purity

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit sermorelin acetate powder inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0