Sign In | Join Free | My phrmg.org
phrmg.org
Products
Search by Category
Home > Chemicals > Pharmaceuticals > Animal Pharmaceuticals >

Human Growth Hormone Increase Height

1-10 Results for

human growth hormone increase height

from 323 Products

Pure Injectable Human Growth Hormone For Height Hygetropin CAS 96827-07-5

China Pure Injectable Human Growth Hormone For Height Hygetropin CAS 96827-07-5 on sale
..., 191AA Human Growth Hgh Human Growth Hormone For Women HGH Blue Top10 Vials / Kit Hunman Growth Hormone detail Growth hormone, also known as human growth hormone, typically used for the treatment of dwarfism. It has anabolic effects, may increase muscular......
Global chemicals Co.,Ltd

Hexarelin Human Growth Hormone Peptide

China Hexarelin Human Growth Hormone Peptide on sale
...Hexarelin Human Growth Hormone Peptide Lyophilized inject for Muscle Building Detailed Product Description Product Name: Hexarelin Appearance: Lyophilized powder ......
Yihan Industrial Co.,Ltd.

Address: Room 301-7A,3/F,HongKong Trade Centre,161-167 DES VOEUX ROAD,CENTRAL,HK

Injectable Human Growth Hormone For Height Hygetropin 200iu Kit 96827-07-5

China Injectable Human Growth Hormone For Height Hygetropin 200iu Kit 96827-07-5 on sale
... Mass Body Building Human growth hormone supplements Hygetropin 200 iu / kit CAS NO.96827-07-5 Growth hormone(), also known as human growth hormone, typically used for the treatment of dwarfism. It has anabolic effects, may increase muscular physique, but......
Shandong Chuangrui Chemical Technology Co., Ltd.

Address: shandong province, China

Human Growth Hormone Peptide Humatropin in 16iu Pre Filling / Injection GH Pen

China Human Growth Hormone Peptide Humatropin in 16iu Pre Filling / Injection GH Pen on sale
... kits/month Jintropin 191aa Human Growth Hormone kit for sale. Original Jintropin by GeneScience Pharmaceuticals Ltd. is a lyophilized (freeze-dried) white powder packed in a sealed box containing 10 x 10 iu/vials. History: HGH(Human Growth...
Wuhan Body Biological Co.,Ltd

Address: Room 4331, 3th building, high-tech industrial park, yizhi road, qingshan district, wuhan, China

10 IU Genetropin Human Growth Hormone For Children Increase Height

China 10 IU Genetropin Human Growth Hormone For Children Increase Height on sale
... Genetropin Human Growth Hormone For Children Increase Height We can supply Genetropin 10 IU/val as the picture shows. Important Safety Information & Indications Growth hormone should not be used to increase height in children after the growth plates have......
Hongkong Kangdisen Medical Co., Limited

Address: ROOM C1D, 6/F, WING HING INDUSTRIAL BUILDING, 14 HING YIP STREET, KWUN TONG, KOWLOON, HONG KONG

Hygetropin 100 IU / Human Growth Hormone Anabolic Steroid Peptides Muscle Building

China Hygetropin 100 IU / Human Growth Hormone Anabolic Steroid Peptides Muscle Building on sale
...Hygetropin 100 IUFitness Grow Human Anabolic Steroid Hormone Peptides HGh Fragment Hygetropin 100IU Bodybuild rHGH Usage: injectable, Bodybuilding, Muscle Building, etc. Suggested dosage: ......
Landmark Nutraceuticals Co., Limited

Address: Unit 04, 7/F, Bright Way Tower, NO. 33 Mong Kok Road, KowLoon, Hongkong

Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5

China Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5 on sale
...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ......
Jiangsu Biostronger Technology Co.,Ltd

Address: Hehai Road, Xinbei disctrict, Changzhou, Jiangsu, China

Injectable Human Growth Hormone For Bodybuilding Supplements Steroids Hgh Riptropin

China Injectable Human Growth Hormone For Bodybuilding Supplements Steroids Hgh Riptropin on sale
... Supplements Steroids Human Growth Hormones 10IU/vial,10vials/kit Product Description: Riptropin [rDNA origin] is a way to supply natural growth human growth hormone for people who may deficient or may require higher levels of this hormone. Riptropin is......
Shandong Shengri Chemical Co., Ltd.

Address: Lanshan district, linyi city, shandong province, China

CAS NO. 140703-51-1 Human Growth Hormone Peptide Hexarelin Acetate 2mg /Vial

China CAS NO. 140703-51-1 Human Growth Hormone Peptide Hexarelin Acetate 2mg /Vial on sale
...Anti-Aging Human Hormone Steroids Hexarelin Acetate 2mg /Vial CAS 140703-51-1 Quick Detail: Product name: Hexarelin Synonym: L-Histidyl-2-......
Pharmlab Co.,Ltd

Address: Zhang zhidong road , Wuchange District ,Wuhan City ,Hubei Province

Anti HGH Hygetropin Injectable Bodybuilding Human Growth Hormone Peptides

China Anti HGH Hygetropin Injectable Bodybuilding Human Growth Hormone Peptides on sale
... Hygetropin Purity (HPLC): 98.23%. Hygetropin Appearance:White Powder Hygetropin Grade : Pharmaceutical Grade Keywords : Bodybuilding;Human Growth Hormone;Hygetropin;HGH Hygetropin...
HongKong Blue Universal Co., Limited.

Address: UNIT 04 7/F BRIGHT WAY TOWER NO.33 MONG KOK RD , KL, HONGKONG

Submit your human growth hormone increase height inquiry in a minute :
*From:
Your email address is incorrect!
To:

HongKong Blue Universal Co., Limited.

Products: Anti HGH Hygetropin Injectable Bodybuilding Human Growth Hormone Peptides

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit human growth hormone increase height inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0