Home > Chemicals >

Organic Salt

Organic Salt

All Organic Salt wholesalers & Organic Salt manufacturers come from members. We doesn't provide Organic Salt products or service, please contact them directly and verify their companies info carefully.

Total 2618 products from Organic Salt Manufactures & Suppliers
 RoSh 3-Dots Sensitive Cobalt Free Humidity Indicating Cards Brown To Green Manufactures

Brand Name:SHMM

Model Number:HIC01,02,03,04,05,06

Place of Origin:Shanghai China

RoSh 3-Dots Sensitive Cobalt Free Humidity Indicator Card Brown To Green 1. Brief Allow a quick and low cost inspection of whether the humidity level is safe Lead-free RoHS compliant. Reversible color change, OEM allowed 2. Application Printed Circuit ...

Shanghai Hengyuan Macromolecular Materials Co.,Ltd.
Verified Supplier

Shanghai

 Testosterone Steroids Pharmaceutical Testosterone Undecanoate For Bodybuilding Manufactures

Brand Name:steroidphoebe

Model Number:5949-44-0

Place of Origin:China

Testosterone Steroids Pharmaceutical Testosterone Undecanoate For Bodybuilding Testosterone undecanoate (Steroids) Test unde Testosterone undecanoate Testosterone unde Test undecanoate Test unde 98% min. Test unde CAS NO.: 5949-44-0 English Synonyms: ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

 CAS 2529-45-5 Estrogen Hormone Synthetic Progesterone Flugestone Acetate Manufactures

Brand Name:nutritionsteroid

Model Number:kobe@chembj.com

Place of Origin:China

Flugestone Acetate Flugestone 17-acetate Synonyms: 4-PREGNEN-9-ALPHA-FLUORO-11-BETA, 17-DIOL-3,20-DIONE ACETATE;FLUOROGESTONE ACETATE;FLUGESTONE ACETATE;17-(acetyloxy)-9-fluoro-11-hydroxy-20-dion(11-beta)-pregn-4-ene-;20-dione,9-fluoro-11-beta,17-...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

 led strip aluminum extrusion, LED profile for shelves Manufactures

Brand Name:koner

Model Number:AL-M004

Place of Origin:china

Aluminum LED Profiles designer& Manufacturer; Linear LED Strip Profiles are the excellent option to take your LED light Strip installations to the next level. kinds of Aluminum LED profile with frosted diffusor used for led strips, 1- Anodized extrusions ...

KONER LTD
Active Member

 Bodybuilding Steroids Raw Powder Testosterone Enanthate CAS 315-37-7 Test E Manufactures

Brand Name:JNJG

Model Number:Primoteston-Depot

Place of Origin:CHINA

Specification: Product Name Primoteston-Depot Primoteston-Depot Alias Testosterone Enanthate Primoteston-Depot CAS 3704-09-4 Primoteston-Depot MF C20H30O2 Primoteston-Depot MW 302.4558 Apperance white crystalline powder EINECS 206-253-5 Usage ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

 Printed Pineapple Tree Clutch Bag black assorted color block handbag for lady Small messenger bag with chain handle Manufactures

Brand Name:Customized Logo

Model Number:ZD1807

Place of Origin:Guangzhou China

Printed Pineapple Tree Clutch Bag black assorted color block handbag for lady Small messenger bag with chain handle Guangzhou Anbo Industry Co., Ltd. was establised in 2008, is specialized in Manufacturing. Its 15 kilo meters away from Baiyun Airport and ...

Guangzhou Anbo Industry Co.,Ltd.
Active Member

 Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Manufactures

Brand Name:Sendi

Model Number:ycwlb045@yccreate.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

 Powerful Equipoise Boldenone Powder , Reliable Equipoise Boldenone Hormone Manufactures

Brand Name:CZG

Model Number:ST27

Place of Origin:China

Hormone Steroid CAS 13103-34-9 Equipoise EQ Boldenone Undecylenate Product Description Equipoise / Boldenone Undecylenate for a cutting cycle will find they are more vascular than without, possess a grainier look as well are able to maintain more muscle ...

ChangZhou General Imp&Exp Co,.LTD
Verified Supplier

Jiangsu

 Colorless Liquid Butyl Benzoate , CAS 136-60-7 99% Purity For Flavour And Fragrance Manufactures

Brand Name:BYT

Place of Origin:Shandong,China

Butyl Benzoate CAS NO.136-60-7 99% Purity Colorless to Light Yellow Liquid CAS NO 136-60-7 Catalog No ZCF05055 Synonyms n-Butyl benzoate Molecular Formula C11H14O2 Molecular Weight 178.23 Purity 98% mp -22 °C bp 250 °C Fp 223 °F Density 1.01 g/mL ...

Wuhan Biet Co.,Ltd
Verified Supplier

Hubei

 Test Cypionate Muscle Buidling Steroids Anabolic Powder Testosterone Cypionate Manufactures

Brand Name:HongQiang

Model Number:58-20-8

Place of Origin:China(Mainland)

Factory Direct Sales Anabolic Steroid Raw Powder Testosterone Cypionate for Muscle Buidling 58-20-8 Product Description Testosterone cypionate Synonym: Testosterone cypionate; Good quality Testosterone cypionate; Test cypionate; CAS No: 58-20-8 Molecular ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

 Auto Conveyor Metal Detector 3020 (for bottle packing product inspection) Manufactures

Model Number:JL-IMD/M4012

Place of Origin:China

Metal detector,metal detectors machine,industrial metal detector,food metal detector,meat metal detector,chicken metal detector,fish metal detector,toy metal detector,tunnel metal detector,digital metal detectors machine,belt metal detector,conveyor metal...

JINLONG INDUSTRIAL CO.,LTD.
Site Member

Shanghai

 Solid Urea Formaldehyde Resin Powder , Urea Moulding Powder Wear Resistance Manufactures

Brand Name:HONINGLITE

Model Number:UF1P-C5

Place of Origin:CHINA

Urea Moulding Compound Compression Grade in Powder for Molding Household handles Product description Urea Moulding compound are produced from Urea-formaldyde resion with cellulose fillers and are available in an unlimited range of colors. Parts moulded ...

Jiaxing Honing Import&Export CO,.LTD
Verified Supplier

Zhejiang

 Fitness Muscle Growth Masteron Propionate for Sportsman Pharmaceutical Grade Steroids Manufactures

Brand Name:wumeitech

Model Number:521-12-0

Place of Origin:China

Fitness Muscle Growth Masteron Propionate for Sportsman Pharmaceutical Grade Steroids Drostanolone Propionate Details: Product Name Drostanolone Propionate DrostanolonePropionate Alias Masteron; Dromostanolone Propionate DrostanolonePropionate Purity 99%...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

 Sodium formate 95% Manufactures

Price:USD290/mt FOB Tianjin

Packaging Details:25kg/pp bag

Delivery Time:within one week

Sodium Formate CAS No 141-53-7 Molecular Formula CHNaO2 Molecular Weight 68.01 Appearance White Crystal Powder Purity. % ,min. 92.0-94.3 Organic impurities ,wt. % ,min. 2.0 Moisture,wt. % ,max. 2.0 Chloride ,wt. % ,max. 1.0 Introduction Sodium formate is ...

Chems Co., Ltd.-RYCCL
Site Member

Guizhou

 Steroids Formestane CAS 566-48-3 High Purity 99% Lentaron Powder Manufactures

Brand Name:skype:Amandary

Model Number:white powder

Place of Origin:China

Steroids Formestane CAS 566-48-3 High Purity 99% Lentaron Powder skype:Amandary whatsAPP:0086 18108469312 e-Mail:puresteroids@ycphar.com Product Details Chemical Name: 4-Androsten-4,17β-ol-3-one CAS:566-48-3 White powder Molecular Formula: C19H28O3 ...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

 CAS 51022-70-9  Pharmaceutical Ingredient Salbutamol Sulfate Albuterol Sulfate Fitness Steroids Manufactures

Brand Name:HKYC

Model Number:99%

Place of Origin:CHINA

CAS: 51022-70-9 Pharmaceutical Ingredient Salbutamol Sulfate Albuterol Sulfate Fitness Steroids Quick Detail: Product Name: Albuterol Sulfate Alias: Ventolin; Proventil CAS: 51022-70-9 MF: (C13H21NO3)2·H2SO4 MW: 576.71 EINECS: 242-424-0 Storage: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

 CAS 50-50-0 Pharmaceutical Raw Materials Estradiol Benzoate Raw Powder Manufactures

Brand Name:Kafen

Model Number:50-50-0

Place of Origin:China

Estradiol benzoate Synonyms:N-oxidation of rifampicin (3 - hydroxy-female steroid -1,3,5 (10) - triene-17b-ol -3 - benzoic acid ester) CAS NO: 50-50-0 Molecular Formula: C25H28O3 Molecular Weight: 376.49 Content: 99% Physical Properties: white or slightly...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

 CAS 862-89-5 Factory Direct Supplying Nandrolone Undecylate for Bodybuilding Manufactures

Brand Name:Gear Steroids

Model Number:862-89-5

Place of Origin:CHINA

High Quality CAS 862-89-5 Factory Direct Supplying Nandrolone Undecylate for Bodybuilding 1, Quick Detail Model NO.: 862-89-5 Customized: Customized Suitable for: Elderly, Children, Adult Purity: >99% Synonyms: Nandrolone Undecanoate Mf: C29h46o3 Usage: ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

 ENT unit with automatic suction system Manufactures

Brand Name:Jialianda

Model Number:pioneer

Place of Origin:China

Aesthetic shape and advanced technology metal frame with epoxy painting UV resistant plastic cover White marble working table Mobile structure on heavy duty wheels Automatically switched on/off for compressed air and suction when Handpiece is taken out ...

Foshan Jialianda Medical Apparatus Co. Ltd.
Active Member

 High Quality 99% Pharmaceutical Raw Materials CAS 609799-22-6 Hetlioz Tasimelteon Manufactures

Brand Name:purity

Model Number:1030377-33-3

Place of Origin:china

Factory Sale High Quality 99% CAS 609799-22-6 Hetlioz Tasimelteon Tasimelteon Name Tasimelteon Other Name:Hetlioz Tasimelteon Purity: >99% Tasimelteon CAS: 609799-22-6 Tasimelteon Molecular Weight: 245.322 Tasimelteon Certification: ISO 9001, USP, BP ...

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Go to Page
Inquiry Cart 0