•  Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building Manufactures
    ...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ... more
    Brand Name:SD
    Model Number:99%
    Place of Origin:shenzhen,china

    Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building

  •  Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality Manufactures
    ...Bodybuilding Peptides Sermorelin Acetate 2mg/vial Human Growth Hormones For Fat Loss Description Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ... more
    Brand Name:Yihan
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Acetate Human Growth Hormone Peptide For Improving Sleep Quality

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  •  White Powder Human Growth Hormone Peptide GHRH Sermorelin Acetate 2mg/ Vial Manufactures
    ... disc which contains 2mg of lyophilized Sermorelin Acetate.The Bacteriostatic Water is mixed with the Sermorelin to provide solution for injection. Sermorelin 2mg/vial Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number 86168-78... more
    Brand Name:YIHAN
    Model Number:86168-78-7
    Place of Origin:China

    White Powder Human Growth Hormone Peptide GHRH Sermorelin Acetate 2mg/ Vial

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  •  LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 Manufactures
    ...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is Geref), also... more
    Brand Name:YUANHANG
    Model Number:86168-78-7
    Place of Origin:CHINA

    LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7

  •  Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss Manufactures
    ... Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description: more
    Brand Name:steriodshow
    Model Number:86168-78-7
    Place of Origin:china manufactuer

    Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss

  •  2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Manufactures
    ...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ... more
    Brand Name:Muscle Man
    Model Number:400
    Place of Origin:Hunan,China

    2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder

  •  99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Manufactures
    ...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ... more
    Brand Name:HongKong Blue
    Model Number:CAS No.: 86168-78-7
    Place of Origin:CHINA

    99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning

  •  Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Manufactures
    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ... more
    Brand Name:Sermorelin
    Model Number:87616-84-0
    Place of Origin:china

    Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder

    Pharmlab Co.,Ltd
    [Hubei,China]
  •  Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 For Breast Cancer Manufactures
    ...Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 for Breast Cancer Name: Exemestane CAS NO: ... more
    Brand Name:TJ
    Model Number:107868-30-4
    Place of Origin:CHINA

    Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 For Breast Cancer

  •  White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 Manufactures
    ... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity... more
    Brand Name:Yuancheng
    Model Number:86168-78-7
    Place of Origin:WUHAN

    White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29

  •  Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available Manufactures
    ...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ... more
    Brand Name:HBYC
    Model Number:HBYC
    Place of Origin:China

    Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available

  •  CAS 86168 78 7 Peptide Hormones Bodybuilding  High Purity Steroid Sermorelin Acetate Manufactures
    ...Supply High Purity steroid Peptide Hormone Sermorelin / Sermorelin Acetate 2mg Vials for Fat Burning Sample Free Base information of Sermorelin acetate Chemical Name: Sermorelin acetate CAS No : 86168-78-7 Sequence :H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr... more
    Brand Name:MOBELBIO
    Place of Origin:China
    Certification:GMP,ISO

    CAS 86168 78 7 Peptide Hormones Bodybuilding High Purity Steroid Sermorelin Acetate

  •  Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed Manufactures
    ... Step Guide For Making Tren Ace 100 Oil. The recipe for 1000 ml of trenbolone acetate @ 100 mg/ml we use: powders: 100 grams; BA: 2%, 20 ML BB: 10%, 100 ML... more
    Brand Name:TINGYI
    Model Number:10161-34-9
    Place of Origin:China

    Finaplix H / Revalor-H Trenbolone Acetate Trenbolone Raw Steroid Powder Shipping Guaranteed

  •  Sell Pharmaceutical Grade 99% Purity Teriparatide Acetate Raw Powder CAS: 52232-67-4 Manufactures
    ...Basic info. Product Name: Teriparatide Acetate Sequence: Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-... more
    Brand Name:Kafen
    Model Number:52232-67-4
    Place of Origin:China

    Sell Pharmaceutical Grade 99% Purity Teriparatide Acetate Raw Powder CAS: 52232-67-4

  •  Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results Manufactures
    ...Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results Wuhan Lianshangwang Technology Co.,LTD Contact person:helena liu coco@yuanchengtech.com whatsapp:+86 ... more
    Brand Name:coco@yuanchengtech.com
    Model Number:106612-94-6
    Place of Origin:China

    Tesamorelin Growth Hormone Peptides Loss Body Fat With Effective Results

  •  Raw Pharmaceutical Grade Peptides Ghrp 2 Acetate Somatropin Powder CAS 158861-67-7 Manufactures
    ... Amino Acid Composition: about10% of theoretical Peptide Content (N%): 80.0% min. Water Content(Karl Fischer): 6.0% max. Acetate Content (HPIC): 12.0% max. MS(ESI): Consistent Mass Balance: 95.0~105.0% Appearance: White powder Payment... more
    Brand Name:shinrezing
    Model Number:158861-67-7
    Place of Origin:China

    Raw Pharmaceutical Grade Peptides Ghrp 2 Acetate Somatropin Powder CAS 158861-67-7

  •  Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial Manufactures
    ... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate... more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Injectable Growth Hormone Muscle Buildig Peptides Sermorelin Acetate 2mg/vial

  •  Sermorelin Acetate Powder Manufactures
    ... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human... more
    Place of Origin:China
    Delivery Time:3 days
    Payment Terms:WU, t/t

    Sermorelin Acetate Powder

  •  Strength Enhancement Peptide Hormones Bodybuilding Sermorelin Acetate Manufactures
    ... Hormones Bodybuilding Sermorelin Acetate Sermorelin Details: Sermorelin Spefication 2mg/vial Sermorelin Synonyms Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin CAS No. 86168-78-7 Sermorelin M F C149H246N44O42S Sermorelin M W 3357.88 Sermorelin Usage... more
    Brand Name:wumeitech
    Model Number:86168-78-7
    Place of Origin:China

    Strength Enhancement Peptide Hormones Bodybuilding Sermorelin Acetate

  •  Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee Manufactures
    ...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ... more
    Brand Name:Youngshe
    Model Number:YSPI
    Place of Origin:Chengdu , China

    Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee

Tell “sermorelin acetate side effects” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0