•  98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Manufactures
    98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): 98.0%min. Appearance: White powder Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Single Impurity (HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content (N%): ≥80.0% Water Content (Karl Fischer): ≤8.0% Acetate Content (HPIC): ≤12.0% MS (ESI): Consistent Specific Rotation (20/D): -80.0~ more
    Brand Name:Yuancheng
    Model Number:86168-78-7
    Place of Origin:Wuhan,Hubei

    98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building

  •  Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth Manufactures
    Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth 1 . Quick Details: Product Name: PEG MGF Appearance : White Lyophilized powder Specification : 2mg/vial Assay: 98%min Storage : 2-8 degree centigrade refrigerator Delivery Time: Within 12 hours after receiving your payment Payment Terms : Western Union, Money Gram, Bitcoin, Bank Transfer, T/T. 2 . Product Description: PEG MGF is a splice variant of the IGF produced by a frame shift if the IGF gene and PEGylated to ... more
    Brand Name:Kafen
    Model Number:qualified
    Place of Origin:Guangdong

    Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth

  •  Ipamorelin Muscle Building Peptides Supplements , Muscle Growth / Fat Burning Peptides CAS 170851-70-4 Manufactures
    Muscle Mass Gaining Peptide Ipamorelin (2mg/Vial) Basic Details: Product Name: Ipamorelin CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.85296 Appearance: White Lyophilized Powder Method of Analysis: HPLC Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C. Description: Ipamorelin is a growth-hormone-releasing formula. It is more
    Brand Name:TINGYI
    Model Number:CAS: 170851-70-4
    Place of Origin:CHINA

    Ipamorelin Muscle Building Peptides Supplements , Muscle Growth / Fat Burning Peptides CAS 170851-70-4

  •  Injectable Peptides Hormones Ipamorelin 2mg / Vial For Muscle Growth and Weight Loss Manufactures
    Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:Hong Kong, Hong Kong Production Capacity:10000vials/Month Payment Terms:T/T, Western Union, Money Gram Model NO.: 170851-70-4 Customized: Customized Suitable for: Adult Purity: >99% Character: White Lyophilized Powder Molecular Weight: 711.86 Trademark: HKYC Specification: 2mg/vial, 10vials/kit HS Code: 2901292000 Powder: Yes Certification: GMP, HSE, ISO 9001, USP State: Solid CAS No.: 170851 more
    Brand Name:HBYC
    Model Number:HBYC
    Place of Origin:China

    Injectable Peptides Hormones Ipamorelin 2mg / Vial For Muscle Growth and Weight Loss

  •  Growth Hormone Peptide Ipamorelin CAS 170851-70-4 Ipamorelin 2mg For Muscle Building Manufactures
    Growth Hormone Peptide Ipamorelin CAS 170851-70-4 Ipamorelin 2mg For Muscle building Base information of Ipamorelin Product name: Ipamorelin CAS No: 170851-70-4 MF: C38H49N9O5 MW:711.86 Purity: 99% Min Appearance: white freeze-dried powder Storage at: Cool dry place Sample orders:1 grams Delivery: Within 3-5days Shipping: By Express DHL/TNT with tracking number provided Return&Refunds Policy: Resend products or return funds if quality problems or damaged Quality Reports of Ipamorelin Purity( more
    Brand Name:MOBELBIO
    Place of Origin:CHINA
    Certification:GMP,ISO

    Growth Hormone Peptide Ipamorelin CAS 170851-70-4 Ipamorelin 2mg For Muscle Building

  •  GHRP-2 Human Growth Peptide for Muscle Growth Bodybuilding Peptides CAS:158861-67-7 Manufactures
    ...GHRP-2 Human Growth Peptide for Muscle Growth Bodybuilding Peptides CAS:158861-67-7 1.Detailed Product Description: Product Name GHRP-2 Delivery time Within 2 days after received ... more
    Brand Name:SR
    Model Number:CAS 158861-67-7
    Place of Origin:China

    GHRP-2 Human Growth Peptide for Muscle Growth Bodybuilding Peptides CAS:158861-67-7

  •  Muscle Growth Body Building Steroid Raw Powder Methenolone Acetate Primobolone Manufactures
    ...Build Muscle Growth Steroid Raw Powder Methenolone Acetate Primobolone About Us 1 . We are Chinese factory supplier . our product are more than 300 kinds of , inculding Steroids powder / liquids and Pro hormone and peptide... more
    Brand Name:Blue Universal
    Model Number:434-05-9
    Place of Origin:China

    Muscle Growth Body Building Steroid Raw Powder Methenolone Acetate Primobolone

  •  PT141 CAS 189691-06-3 Growth Hormone Releasing Peptide For Muscle Growth Health Manufactures
    ...PT141 CAS 189691-06-3 Growth Hormone Peptides For Muscle Growth Health Quick Detail: Product Name PT-141;PT141 CAS NO 189691-06-3 MF C50H68N14O10 MW ... more
    Brand Name:Pharmlab
    Model Number:189691-06-3
    Place of Origin:China

    PT141 CAS 189691-06-3 Growth Hormone Releasing Peptide For Muscle Growth Health

    Pharmlab Co.,Ltd
    [Hubei,China]
  •  HGH Strongest Peptide For Muscle Growth Selank   129954-34-3 Manufactures
    ...HGH Strongest Peptide For Muscle Growth Selank 129954-34-3 Selank · Selank is a nootropic, anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. ... more
    Brand Name:Steroid(Saichuang)
    Model Number:99
    Place of Origin:China

    HGH Strongest Peptide For Muscle Growth Selank 129954-34-3

  •  Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth Manufactures
    ...Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth 1 . Quick Details: Product Name: PEG MGF Appearance : White Lyophilized powder Specification : 2mg/vial Assay: 98%... more
    Brand Name:Kafen
    Model Number:qualified
    Place of Origin:Guangdong

    Bulking Cycling Growth Hormone Peptides , PEG MGF peptides for muscle growth

  •  99 Purity IGF-1LR3 Peptide Legal Human Growth Hormone For Fat Loss & Muscle Building Manufactures
    ...IGF-1LR3 Human Growth Hormone 99 Purity Peptides for Fat Loss & Muscle Building Key Words : IGF -1LR3 IGF- 1 DES IGF-1LR3 IGF Dosage IGF Half life IGF -... more
    Brand Name:TY-Chemical
    Model Number:946870-92-4
    Place of Origin:China

    99 Purity IGF-1LR3 Peptide Legal Human Growth Hormone For Fat Loss & Muscle Building

  •  Oral Anabolic Steroids 99% Purity Powder Metandienone / Dianabol For Muscle Growth CAS 72-63-9 Manufactures
    ...Oral Anabolic Steroids 99% Purity Powder Metandienone/Dianabol for Muscle Growth CAS 72-63-9 Quick Detail: Product name Metandienone Other name Dianabol CAS register number 72-... more
    Brand Name:TJ
    Model Number:99%
    Place of Origin:China

    Oral Anabolic Steroids 99% Purity Powder Metandienone / Dianabol For Muscle Growth CAS 72-63-9

  •  Mechano Growth Factor Natural Human Growth Hormone , Peptides For Muscle Growth Manufactures
    ...Muscle Gaining Mgf Growth Mechano Factor Peptides Hormone Peg-Mgf (2mg/5mgVIAL) paypal Quick detail: MGF 2MG - Mechano GrowthFactor Pegylated Mechano GrowthFactor (... more
    Brand Name:YIHAN
    Model Number:MFG (Mechano growthfactor) (I*GF- IEC)
    Place of Origin:CHINA

    Mechano Growth Factor Natural Human Growth Hormone , Peptides For Muscle Growth

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  •  Strength Increasing Muscle Building Peptides Injection Muscle Building Polypeptide ACE - 031 Peptides For Lean Manufactures
    ... and veterinary purposes. ACE-031 is a soluble fusion protein that has been shown to increase muscle mass and strength in research studies. ACE-031 is being studied as a treatment for metabolic... more
    Brand Name:Follistatin 344 peptide
    Model Number:Follistatin 344 peptide
    Place of Origin:China

    Strength Increasing Muscle Building Peptides Injection Muscle Building Polypeptide ACE - 031 Peptides For Lean

  •  200iu Kigtropin HGH , 20iu / Vial 191AA Grade GH Strongest Peptide For Muscle Growth Manufactures
    ...200iu Kigtropin Brand Human Growth Hormone Peptide HGH 20iu/vial 191AA grade GH Basic information: CAS No. : 96827-07-5 Purity : 97% Place ... more
    Brand Name:Bodybiological
    Model Number:96827-07-5
    Place of Origin:Hubei, China

    200iu Kigtropin HGH , 20iu / Vial 191AA Grade GH Strongest Peptide For Muscle Growth

  •  IGF - 1LR3 Injectable Peptides / Mecasermin Peptides For Muscle Growth Manufactures
    ...Hot Sale Igf-1lr3 for Injectable Muscle Growth Igf-1lr3 Mecasermin Peptide Product information: Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White ... more
    Brand Name:FILTER
    Place of Origin:China
    Minimum Order Quantity:10 vials

    IGF - 1LR3 Injectable Peptides / Mecasermin Peptides For Muscle Growth

  •  Hexarelin Human Growth Peptides Hexarelin Synthetic Growth Hormone releasing Peptide Manufactures
    ...Human Growth Peptides Hexarelin Synthetic Growth Hormone releasing Peptide Hexarelin Peptide Details: Product Name: Hexarelin Alias: Examorelin,HEX,Hexarelin Acetate Molecular Formula: C47H58N12O6 MW : 887.04022 ... more
    Brand Name:DS
    Place of Origin:China
    Certification:ISO9001

    Hexarelin Human Growth Peptides Hexarelin Synthetic Growth Hormone releasing Peptide

  •  White Methyltrienolone Metribolone For Male Muscle Growth Cas 965 93 5 Manufactures
    ...Methyltrienolone/ METRIBOLONE for Male Muscle Growth Powder CAS: 965-93-5 Synonyms: METRIBOLONE CAS: 965-93-5 MF: C19H24O2 MW: 284.39 Assay: ... more
    Brand Name:YC
    Model Number:965-93-5
    Place of Origin:China

    White Methyltrienolone Metribolone For Male Muscle Growth Cas 965 93 5

  •  Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping Manufactures
    ... weight: 3367.97 Purity: 98% Traits: white powder CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of more
    Brand Name:KA-XING
    Model Number:315-37-7
    Place of Origin:Guangdong ,China

    Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping

  •  Muscle Growth Peptide Growth Hormone CJC 1295 With DAC 2mg 51753-57-2 Pharma Grade Manufactures
    ...CJC 1295 Human Growth Peptide GH Powder CJC1295 DAC CAS 51753-57-2 CJC-1295 Peptide Profile: Product Description: CJC-1295 2mg/Vial Product Name: CJC-1295 Type: Immune Function AgentsGrade ... more
    Brand Name:Hongxi Pharm
    Model Number:Hormone Peptide
    Place of Origin:HongKong

    Muscle Growth Peptide Growth Hormone CJC 1295 With DAC 2mg 51753-57-2 Pharma Grade

  •   Fragment Bodybuilding  Kigtropin 100IU / Anabolic Steroid Hormones / Muscle Growth Peptides HGh Manufactures
    ...Fragment Bodybuilding Kigtropin 100IU / Anabolic Steroid Hormones / Muscle Growth Peptides HGh Details: Color Fine Yellow color Apperance powder Delivery time Within 2 days after received payment ... more
    Model Number:kigtropin
    Place of Origin:China
    Certification:SGS

     Fragment Bodybuilding Kigtropin 100IU / Anabolic Steroid Hormones / Muscle Growth Peptides HGh

  •  Muscle Growth Human Growth Hormone Genotropin  HGH PEN 12629-01-5 For Bodybuilding Functions Manufactures
    ...Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions Cas No. 12629-01-5 Size: 36iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ... more
    Brand Name:SGH
    Model Number:12629-01-5
    Place of Origin:China

    Muscle Growth Human Growth Hormone Genotropin HGH PEN 12629-01-5 For Bodybuilding Functions

  •  Ipamorelin Muscle Building Peptides Supplements , Muscle Growth / Fat Burning Peptides CAS 170851-70-4 Manufactures
    ...Muscle Mass Gaining Peptide Ipamorelin (2mg/Vial) Basic Details: Product Name: Ipamorelin CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.85296 Appearance: White Lyophilized Powder Method of Analysis: HPLC Storage: Lyophilized peptides although stable... more
    Brand Name:TINGYI
    Model Number:CAS: 170851-70-4
    Place of Origin:CHINA

    Ipamorelin Muscle Building Peptides Supplements , Muscle Growth / Fat Burning Peptides CAS 170851-70-4

  •  Pharmaceutical Human Growth Peptides , PEG-MGF Peptides For Muscle Growth Manufactures
    ... Human Growth Peptides Grow Your Muscles with the PEG-MGF Peptide Alias: PEG-Suc-YQPPSTNKNTKSQ(d)R(d)RKGSTFEEHK-NH2; M.F.: C121H200N42O39 Purity (HPLC): 98.0% Single Impurity(HPLC): 0.5%max. Amino Acid Composition: about 10% of theoretical Peptide Content... more
    Brand Name:Yuancheng
    Model Number:5
    Place of Origin:Wuhan,Hubei

    Pharmaceutical Human Growth Peptides , PEG-MGF Peptides For Muscle Growth

  •  TB500 CAS 77591-33-4 Protein hormones Peptide For Muscle Growth Health Manufactures
    ...TB500 CAS 77591-33-4 Protein hormones Peptide For Muscle Growth Health Product name TB500 CAS No. 77591-33-4 MF C212H350N56O78S MW 4963.49 EINECS 1592732-... more
    Brand Name:RAWSGEAR
    Model Number:77591-33-4
    Place of Origin:China

    TB500 CAS 77591-33-4 Protein hormones Peptide For Muscle Growth Health

Tell “peptides for muscle growth” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0