•  12629-01-5 Hgh Growth Hormone 99% purity Min For Gaining Muscle HGH prptide 10iu/vial Manufactures
    Human growth hormone HGH for gaining muscle 10iu/vial best for gaing muscle HGH Product Name: Human growth hormone,HGH CAS No: 12629-01-5 Molecular Formula: C990H1529N263O299S7 Assay: 98% min Appearance: White loose lyophilized powder. Amino Acidd: 191 Aa Quality Standard: USP/BP/ISO9001 Storage: Store at 8℃-20℃, protect from moisture and light. Human Growth Hormone (HGH) is not only one of the most beneficial hormones our body produces, but one of the most sought after in exogenous form. In an more
    Brand Name:Top Pharm
    Model Number:12629-01-5
    Place of Origin:China

    12629-01-5 Hgh Growth Hormone 99% purity Min For Gaining Muscle HGH prptide 10iu/vial

  •  Fat Loss Hgh Muscle Growth Hormone Supplements Medicine Grade 99% Pure Manufactures
    Injectable Polypeptide Hormone 2000iu / Via Human Chorionic Gonadotropin Hormone The whole name of HCG is Human Chorionic Gonadotropin which is a Powerful Polypeptide Hormone. It plays different roles between male and female. For Women, HCG affects ovulation and fertility. But for men, it may increase or restore testosterone. Besides, the HCG can boost metabolism, threating Cryptochidism, female infertility, etc. At the same time, it can be used as anabolic steroids PCT (Post Cycle Therapy) and more
    Brand Name:Diselbiotech
    Model Number:HCG
    Place of Origin:China

    Fat Loss Hgh Muscle Growth Hormone Supplements Medicine Grade 99% Pure

  •  Hormone Peptide DSIP Bodybuilding Muscle Growth Peptides Delta Sleep-Inducing Peptide Manufactures
    ...Hormone Peptide DSIP Bodybuilding Muscle Growth Peptides Delta Sleep-Inducing Peptide Product Name:Delta sleep-inducing peptide,DSIP DSIP CAS NO:... more
    Brand Name:Holybiological
    Model Number:WhatsApp:+8613545014917
    Place of Origin:China

    Hormone Peptide DSIP Bodybuilding Muscle Growth Peptides Delta Sleep-Inducing Peptide

  •  factory Grade kigtropin Muscle Growth Hormone Powder Hgh Human Growth Hormone Manufactures
    ...factory Grade kigtropin Muscle Growth Hormone Powder Hgh Human Growth Hormone 1. Details Product Name:kigtropin Appearance: freeze-dried powder Application: Used in medical research, lab research ... more
    Brand Name:DS
    Place of Origin:China
    Certification:ISO 9001

    factory Grade kigtropin Muscle Growth Hormone Powder Hgh Human Growth Hormone

    RCchemshop
    [Shandong,China]
  •  Fat Loss Hgh Muscle Growth Hormone Supplements Medicine Grade 99% Pure Manufactures
    ...Injectable Polypeptide Hormone 2000iu / Via Human Chorionic Gonadotropin Hormone The whole name of HCG is Human Chorionic Gonadotropin which is a Powerful Polypeptide Hormone. It plays different roles between male and female. For Women... more
    Brand Name:Diselbiotech
    Model Number:HCG
    Place of Origin:China

    Fat Loss Hgh Muscle Growth Hormone Supplements Medicine Grade 99% Pure

  •  buy Medicine Grade Igtropin Muscle Growth Hormone Powder Hgh Supplements with Strong Effect Manufactures
    ...buy Medicine Grade Igtropin Muscle Growth Hormone Powder Hgh Supplements with Strong Effect Description: 1. Product Name : Igtropin 2. Purity : 99.85% 3. Package : as customer’s requirement 4.Production ... more
    Brand Name:DS
    Place of Origin:China
    Certification:ISO9001

    buy Medicine Grade Igtropin Muscle Growth Hormone Powder Hgh Supplements with Strong Effect

  •  Pharmaceutical Grade GH Growth Hormone Supplement Genotropin 36iu For Bodybuilding Manufactures
    ...Genotropin/Pfizer 36iu/10iu for Muscle Building with GMP From Lab (OEM) Genotropin 36iu Product Name:Genotropin (OEM) Specification:10IU,16IU,... more
    Brand Name:Genotropin/Pfizer
    Model Number:36iu/10iu
    Place of Origin:China

    Pharmaceutical Grade GH Growth Hormone Supplement Genotropin 36iu For Bodybuilding

  •  Original Medicine Grade Blue Cover GH Human Growth Hormone Supplement Manufactures
    ...Original Medicine Grade Blue Cover GH, Human Growth Hormone Supplement Blue top HGH Quick Detail: Product name: Blue top HGH CAS No.: 12629-01-5 Specification: ... more
    Brand Name:Bodybiological
    Model Number:Bleu top GH
    Place of Origin:Hubei, China

    Original Medicine Grade Blue Cover GH Human Growth Hormone Supplement

  •  Natural Human Growth Hormone Supplements Blue Tops HGH 100iu/Kit Freeze Dried Powder Manufactures
    ...Human growth hormone supplements blue tops HGH 100iu/kit freeze-dried powder Quick Details: Product name:Blue tops hgh ... more
    Brand Name:Pharma Grade
    Model Number:100iu
    Place of Origin:Zhejiang,China

    Natural Human Growth Hormone Supplements Blue Tops HGH 100iu/Kit Freeze Dried Powder

  •  White Lyophilized Powder Human Growth Hormone Supplements For Fat Loss Manufactures
    ... 6iu/vial,10vial/kit Somatropin Human Growth Hormoner HGH Free Samples Detailed Description: HGH is an important hormone secreted by the pituitary gland that stimulates the growth of muscles and bones, helps regulate metabolism and... more
    Brand Name:YIHAN
    Model Number:hgh pen
    Place of Origin:CHINA

    White Lyophilized Powder Human Growth Hormone Supplements For Fat Loss

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  •  100iu 200iu HGH Human Growth Hormone Supplements Somatropin Jintropin / Hygetropin Manufactures
    ...100iu, 200iu Human Growth Hormone Supplements Somatropin Jintropin / Hygetropin Specification: Product name HGH Human Growth Hormone Form & Formulations Sterile Filtered white lyophilized (Freeze-Dried) Appearance White powder Purity >99% RP-HPLC ... more
    Brand Name:Holybiological
    Model Number:CAS NO.: 96827-07-5
    Place of Origin:China

    100iu 200iu HGH Human Growth Hormone Supplements Somatropin Jintropin / Hygetropin

  •  Bodybuilding Human Growth Hormone Supplement GDF-8 1mg Muscle Growth Application Manufactures
    ...99% Bodybuilding Human Growth Hormone Peptide GDF-8 1mg For Muscle Growth GDF-8 Quick detail Product name: GDF-8 (Growth Differentiation Factor 8) Purity: >98% Specification: 1mg Storage:2-8 degree centigrade refrigerator Package: 10 Vials/Kit Deliver:1 ... more
    Brand Name:YIHAN
    Model Number:GDF-8
    Place of Origin:China

    Bodybuilding Human Growth Hormone Supplement GDF-8 1mg Muscle Growth Application

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  •  99% Purity Muscle Growth Hormone Steroids Epistane / Methylepitiostanol CAS 4267-80-5 Manufactures
    ...99% Purity Muscle Growth Hormone Steroids Epistane / Methylepitiostanol CAS 4267-80-5 Quick Detail: Name Epistane Synonyms Epi Other Names Epistane, ... more
    Brand Name:TJ
    Model Number:99%
    Place of Origin:China

    99% Purity Muscle Growth Hormone Steroids Epistane / Methylepitiostanol CAS 4267-80-5

  •  Prohormones SteroidsTrendione Trenavar  642-95-9 muscle growth,bodybuilding supplement,human growth Manufactures
    ...Prohormones SteroidsTrendione Trenavar 642-95-9 muscle growth,bodybuilding supplement,human growth Prohormones Steroids Trendione Trenavar 642-95-9 Trendione(Trenavar) Product Name:trendione Synonyms: trendione;Estra-4,9,11-... more
    Brand Name:Steroid(Saichuang)
    Model Number:99
    Place of Origin:China

    Prohormones SteroidsTrendione Trenavar 642-95-9 muscle growth,bodybuilding supplement,human growth

  •  Muscle Gain Jintropin 100iu / Kit 10iu / Vial  Natural Growth Hormone Supplements HGH Manufactures
    ...Muscle Gain Jintropin 100iu / Kit 10iu / Vial Natural Growth Hormone Supplements HGH Email: bestchem90@gmail.com Skype: live:bestchem90 Product Name jintropin Other Name hgh Delivery ... more
    Brand Name:SR
    Model Number:SR
    Place of Origin:CN

    Muscle Gain Jintropin 100iu / Kit 10iu / Vial Natural Growth Hormone Supplements HGH

  •  HGH Human Growth Hormone Supplements Peptide Follistatin 344 / FST 344 Manufactures
    ...HGH Human Growth Hormone FST-344 / Follistatin 344 Lyophilized Peptide Gain Muscle FST-344 / Follistatin 344 Peptide Details: Name: Follistatin 344,FST-344 Synonyms: FST, FS, Activin-... more
    Brand Name:Hongxi Pharm
    Model Number:Hormone Peptide
    Place of Origin:china

    HGH Human Growth Hormone Supplements Peptide Follistatin 344 / FST 344

  •  Follistatin 344 Raw Steroid Powder Muscle Growth Hormone Injections Peptides Cryopreservation Manufactures
    ...FOLLISTATIN 344 Nature Muscle Growth Hormone Injections Peptides Cryopreservation Detailed Product Description Appearance: Powder Purity: 99.9% Production Capacity: 1000kg/month Application: ... more
    Brand Name:FOLLISTATIN
    Model Number:FOLLISTATIN
    Place of Origin:China

    Follistatin 344 Raw Steroid Powder Muscle Growth Hormone Injections Peptides Cryopreservation

  •  Natural Growth Hormone Supplements Cjc-1295 Without Dac For Adult Muscle Enhance Manufactures
    ...Top Sell Peptides Fat Loss Hormone MGF 2mg/vial 5mg/vial for Muscle Gaining Basic Info: Product Name: Cjc-1295 Without Dac Model NO.: API Customized: Customized Suitable ... more
    Brand Name:yuancheng
    Model Number:Cjc-1295
    Place of Origin:China

    Natural Growth Hormone Supplements Cjc-1295 Without Dac For Adult Muscle Enhance

  •  High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation Manufactures
    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ... more
    Brand Name:SGH
    Model Number:12629-01-5
    Place of Origin:China

    High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation

  •  IGF-LR3 1mg/vial Anti-aging Fat Loss IGF LR3 Peptides HGH Growth Hormone Supplements Wrinkle Remover for Women Manufactures
    ...IGF-LR3 Anti-aging Fat Loss IGF LR3 HGH Growth Hormone Supplements Wrinkle Remover for Women IGF-1Lr3 1mg/vial,10vials/kit 0.1mg/vial,10vials/kit 1. Payment & ... more
    Brand Name:YC
    Model Number:CAS: 125-69-9
    Place of Origin:China

    IGF-LR3 1mg/vial Anti-aging Fat Loss IGF LR3 Peptides HGH Growth Hormone Supplements Wrinkle Remover for Women

  •  Igtropin HGH Growth Hormone Supplements Steroids Peptides Injection Igtropin HGH wholesale Manufactures
    ...Igtropin HGH Growth Hormone Supplements Steroids Peptides Injection Igtropin HGH wholesale About us We are Professional supply 100% Original HGH ... more
    Brand Name:Igtropin
    Model Number:Whf@hkhanwei.com
    Place of Origin:Shen Zhen of China

    Igtropin HGH Growth Hormone Supplements Steroids Peptides Injection Igtropin HGH wholesale

  •  Nolvadex Tamoxifen Citrate Muscle Growth Hormone Genox Tamifen 10540-29-1 Manufactures
    ...Nolvadex Tamoxifen Citrate Muscle Growth Hormone Genox Tamifen 10540-29-1 Tamoxifen: 10mg x 60 tablets/bottle is available. Nolvadex (tamoxifen citrate) is a ... more
    Brand Name:KANGDISEN
    Model Number:10mg x 60 tablets
    Place of Origin:China

    Nolvadex Tamoxifen Citrate Muscle Growth Hormone Genox Tamifen 10540-29-1

Tell “muscle growth hormone supplements” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0