•  98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding Manufactures
    98% AICAR Raw Peptide AICAR CAS2627-69-2 Powder for Body-building CAS:2627-69-2 Purity:98% Appearance:white powder M.W.:258.231 M.F.:C9H14N4O5 Packing:10g/foil bag AICAR Storage: Before reconstitution (lyophilized / freeze dried powder): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 36 months. Can be stored at room Temperature (up to 37°C = 99°F) for 90 days. After reconstitution (liquid): Can be stored in the refrigerator (2°C to 8°C = 35°F to 47°F) for 5 days. AIRCAR, also more
    Brand Name:Yuancheng
    Model Number:2627-69-2
    Place of Origin:Wuhan,Hubei

    98% Human Growth Peptides AICAR 2627-69-2 Powder For Bodybuilding

  •  CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding Manufactures
    Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 Molecular Formula C152H252N44O42 One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Physical Apperance white powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as ... more
    Brand Name:BestSteroid
    Model Number:863288-34-0
    Place of Origin:Hubei,China

    CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

  •  Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding Manufactures
    Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 CAS Number 80449-31-6 Molecular Formula C13H16O3 Molecular Weight 751.9 N-terminal Sequence Gly30 specification 1mg/vail / 2mg/vail Assay 99.5% Appearance White powder Follistatin-344 Description Additional scientific study that has been conducted on animal test subjects has also determined that Follistatin 344 acts as an antagonist to myostatin; more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding

  •  98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial Manufactures
    98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial Pegylated Mechano Grow Factor Peptides Hormones Pegylated MGF PEG MGF Pegylated Mechano Grow Factor Peptides Hormones Product name PEG MGF Other name Pegylated Mechano Grow Factor, Pegylated MGF CAS number N/A sjgbolic Molecular formula C121H200N42O39 Molecular weight 2867.2 Assay( Puriy) Above 98% Usage PEG MGF(Pegylated Mechano Grow Factor) As Peptides Hormones Promote your body releases a pulse of an MGF splice ... more
    Brand Name:YIHAN
    Model Number:PEG-MGF
    Place of Origin:China

    98% Assay Medical Raw Steroid Powders Human Growth Peptides Peg Mgf 2mg / Vial

  •  Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF Manufactures
    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight : 2867.2 CAS No. : N/A Sequence: Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln- Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 2 . Description PEGylation is the act of attaching a Polyethylene glycol (PEG) structure to another larger molecule (in this case, MGF). The PEG acts as a protective coating and the theory here is . more
    Brand Name:kafen
    Model Number:HGH-Eptifibatide
    Place of Origin:Guangzhou,China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF

  •  CAS 170851-70-4  Peptides Powder Bodybuilding  CJC-1295 With DAC ISO9001 Standard Manufactures
    CAS 170851-70-4 Injectable Peptides Bodybuilding Pharmaceutical CJC-1295 With DAC CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.853 Assay: 99% Peptide Hormone 2mg/vial CJC-1295 with DAC Bodybuilding Supplements Quality testing: All the steroids only be shipped out before tested in university and lab here. Use Guidance: CJC-1295 is most suited to instances where an individual wishes to inject infrequently and is seeking substantive support for GH production rather than a maximum or near-maximum ... more
    Brand Name:Yuancheng
    Model Number:170851-70-4
    Place of Origin:China

    CAS 170851-70-4 Peptides Powder Bodybuilding CJC-1295 With DAC ISO9001 Standard

  •  Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment Manufactures
    Melanotan II CAS 121062-08-6 Injectable Peptides Bodybuilding For Sexual Dysfunction Treatment Quick Details: * Product name: Melanotan-II/ MT-2* Synonyms: melanotan; Melanotan-II; MT-II* CAS No.: 121062-08-6* Grade: Pharmaceutical Grade * Molecular Formula: C50H71N15O10* Molecular Weight: 1042.1932* Assay: 99%* Packing: 2mg/vial, quantity according to customer\'s detail requirements.* Melting point: 2℃* Boiling point: 225℃* Appearance: White crystalline powder. * Storage: Closed, below 2 ~ 8℃ . more
    Brand Name:YC
    Model Number:CAS NO.: 121062-08-6
    Place of Origin:China

    Melanotan II CAS 121062-08-6 for Sexual Dysfunction Treatment

  •  High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7 Manufactures
    High Purity Peptide GHRP-2 (5 mg or 10 mg/vial) China Peptide Manufacturer Supply Basic Details: Product Name: GHRP-2 CAS: 158861-67-7 MF: C45H55N9O6 MW: 818.0 Density: 1.333g/cm3 Boiling Point: 1407°C at 760 mmHg Storage Temperature: 20°C Refractive index: 1.664 Purity (HPLC): 98.0%min. Appearance: White powder Single Impurity (HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content (N%): ≥80.0% Water Content(Karl Fischer): ≤6.0% Acetate Content (HPIC): ≤12.0% Description: .. more
    Brand Name:TINGYI
    Model Number:CAS: 158861-67-7
    Place of Origin:CHINA

    High Purity Muscle Building Peptides GHRP - 2 , Injectable Peptides Bodybuilding CAS 158861-67-7

  •  Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids Manufactures
    Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids What Does BPC-157 Do? BPC-157 surprisingly has no side effects, and it has been shown in a study to restore tendons, muscles, intestines, teeth, bones, etc. In in vivo studies for humans and rodents, as well as with oral or injectable subcutaneous or intramuscular injection . BPC-157 Was Shown 1, Stimulate the tendon and ligament healing as a result of the growth of tendons, cell survival and cell migration in the model of .. more
    Brand Name:Shanghai Stero
    Model Number:BPC-157
    Place of Origin:China

    Growth Hormone Peptides BPC-157 Injectable Vials Bodybuilding Steroids

  •  Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder Manufactures
    Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank Molecular Weight 751.9 Selank specification: 2mg/vail / 10mg/vail Selank Assay : 99.5% Selank Appearance : White powder Selank Description Selank is a nootropic, anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Selank is a heptapeptide with the . more
    Brand Name:purity
    Model Number:129954-34-3
    Place of Origin:china

    Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder

  •  Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4 Manufactures
    95% IGF-1 LR3 1mg Growth Hormone Peptides 946870-92-4 LR3 IGF1 Human 1, IGF-1 LR3 (1mg) Introduction: Product name: IGF-1 LR3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1, LR3 IGF1 Human IGF-1 LR3 Specification: 1mg per vial IGF-1 LR3 CAS#: 946870-92-4 IGF-1 LR3 Physical Appearance: Sterile Filtered White Lyophilized (freeze-dried) Powder IGF-1 LR3 Source: Escherichia Coli IGF-1 LR3 Purity: Greater than 90.0% as ... more
    Brand Name:Blue Dragon
    Model Number:IGF-1 LR3 (1mg)
    Place of Origin:China Manufacturer

    Human Growth Hormone Peptides Bodybuilding IGF - 1 LR3 Peptide Injection 946870-92-4

  •  Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder Manufactures
    Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides Bodybuilding Product Details: Product Name Gonadorelin Acetate Also known as Gonadorelin Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than 98.00% Application Type Injection Supplying Form Lyophilized Powder In Vials / Pure Raw Powder No Vial Custom Supported. ①. Various Colors of Flip off Caps ②. 2mg/vial , 5mg/vial, 10mg/vial , or no vials . ③. Peptides Blend According to Your Demand. such as CJC more
    Brand Name:Yvonne
    Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial
    Place of Origin:China

    Gonadorelin Acetate Growth Hormone Peptides , Injectable Peptides for Bodybuilding Whiter Powder

  •  Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth Manufactures
    Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth 1. Drostanolone Enanthate Alias: Drostanolone; Drolban; Masteron-E, Masteron Enanthate CAS NO.: 472-61-145 Molecular formula: C27H44O3 Molecular weight: 416.64 Characters: White powder . Melting point: 65℃—68℃ Half life: 8-10 days Detection time: 3months 2. Description Masteron Enanthate is the anabolic steroid that is slow acting, but is acts for longer period of time. In fact, Masteron more
    Brand Name:LANDMARK
    Model Number:HPLC verfied
    Place of Origin:CHINA

    Sample Muscle Mass Steroid Drostanolone enanthate ( CAS 472-61-145 ) with Domestic Shipping for Muscle Growth

  •  Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates Manufactures
    Growth Hormone Peptides GHRP-6 CAS 87616-84-0 For Muscle Increasement Quick Details: Product Name:GHRP-6 (Growth Hormone Releasing Peptide 6) CAS: 87616-84-0 MF: C46H56N12O6 MW: 873.01 Purity (HPLC): 98.0%min. Appearance: White powder Usage: Pharmaceutical intermediates. COA: Product Name GHRP-2 Acetate Sequence Cas No. 158861-67-7 Molecular Formula C45H55N9O6 Molecular Weight 818.0 Purity (HPLC) 98.0%min. Appearance White powder Single Impurity (HPLC) 1.0%max Amino Acid Composition ±10% of ... more
    Brand Name:DW
    Model Number:87616-84-0
    Place of Origin:China

    Injectable Peptides Bodybuilding , Fat Loss Peptides For Pharmaceutical Intermediates

  •  Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building Manufactures
    ...Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building 1, Basic Information Model NO.: 87616-84-0 Suitable for: Adult Purity: >98% Other ... more
    Brand Name:HongKong Blue
    Model Number:Ghrp-6
    Place of Origin:CHINA

    Ghrp-6 Acetate Injectable Peptides Bodybuilding Peptides For Muscle Building

  •  High Purity Muscle Building Peptides GHRP - 2  CAS 158861-67-7 , Injectable Peptides Bodybuilding Manufactures
    ...-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2;(DES-ALA3)-KP-102 CAS 158861-67-7 MF C42H50N8O5 MW 746.91 Product Categories... more
    Brand Name:TINGYI
    Model Number:CAS: 158861-67-7
    Place of Origin:CHINA

    High Purity Muscle Building Peptides GHRP - 2 CAS 158861-67-7 , Injectable Peptides Bodybuilding

  •  Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 Manufactures
    ...Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 Just try a small order to start our cooperation, we will NOT make ... more
    Brand Name:HBYC
    Model Number:HBYC
    Place of Origin:China

    Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0

  •  Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding Manufactures
    ...Anti-aging White powder Growth Hormone Peptides Follistatin 315 For Fat Burning Quick detail Product Name Follistatin-344 Chemical Name Follistatin 344 ... more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Follistatin 315 1mg For Fat Burning / Injectable Peptides Bodybuilding

  •  Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding Manufactures
    ...99% Purity China lab Bodybuilding Peptide Tesamorelin Product Description Tesamorelin, 2mg/vial Sequence: C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-... more
    Brand Name:nanjian
    Model Number:2mg/Vial
    Place of Origin:China

    Tesamorelin Fat Burning Peptides / 99% Purity Injectable Peptides Bodybuilding

  •  High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Manufactures
    ...High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Muscle building Steroids Product Name:2, 4-Dinitrophenol Alias: DNP DNP ... more
    Brand Name:Biofriend
    Model Number:51 - 28 - 5
    Place of Origin:China

    High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5

  •  Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement Manufactures
    ...TB500 Peptide Bodybuilding TB -4 Fragment Thymosin Beta 4 Performance Enhancement Basic Info. Product Name TB-500 Also known as ... more
    Brand Name:LSW
    Model Number:TB500 Lyophilized Powder In Vials / Pure Raw Powder No Vial
    Place of Origin:China TB500

    Pharmaceutical TB500 Peptide Bodybuilding White Powder for Performance Enhancement

  •  High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5 Manufactures
    ...DNP 2, 4-Dinitrophenol Bodybuilding Prohormones CAS 51-28-5 For Fat Burning Product Name:2, 4-Dinitrophenol Alias: DNP DNP CAS No: ... more
    Brand Name:Muscle Bodybuilding
    Model Number:CAS 51-28-5
    Place of Origin:China

    High Purity DNP Injectable Peptides Bodybuilding For Fat Burning CAS 51 - 28 - 5

  •  Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF Manufactures
    ...Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF 1 . Quick Detail 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular ... more
    Brand Name:kafen
    Model Number:HGH-Eptifibatide
    Place of Origin:Guangzhou,China

    Injectable Peptides Bodybuilding / Peptide Growth Hormone Pegylated Mechano PEG MGF

  •  Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding Manufactures
    ...Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding Quick Details : CAS 218949-48-5 SYNONYMS Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-... more
    Brand Name:Pharmlab
    Model Number:218949-48-5
    Place of Origin:China

    Top Service Injectable Peptide Lyophilized Powder Tesamorelin 218949-48-5 for Bodybuilding

    Pharmlab Co.,Ltd
    [Hubei,China]
  •  White Powder Ipamorelin Peptide , Injectable Peptides Bodybuilding Reducing Body Fat Manufactures
    ...Injectable Peptide Hormone Ipamorelin for Reducing Body Fat Description: Ipamorelin is a penta-peptide hormone (Aib-His-D-2-Nal-D-Phe-Lys-NH2), a growth hormone secretagogue and a small molecule ghrelin mimetic ... more
    Brand Name:LSW
    Model Number:170851-70-4
    Place of Origin:China

    White Powder Ipamorelin Peptide , Injectable Peptides Bodybuilding Reducing Body Fat

  •  Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Manufactures
    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS No.:946870-... more
    Brand Name:YIHAN
    Model Number:IGF-1 LR3
    Place of Origin:CHINA

    Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  •  5mg GHRP-6 Peptide Steroid Hormones GHRP For Muscle Growth Injectable Peptide Manufactures
    ...5mg GHRP-6 Peptide Steroid Hormones GHRP For Muscle Growth Injectable Peptide Quick Detail; Name;GHRP-6 Name;Growth hormon releasing peptide-6 CAS;87616-84-0 Molecular Formula;C46H56N12O6 Molecular Weight; 873.01 specification;5mg/vail or... more
    Brand Name:Zhenxiang
    Model Number:GHRP-6
    Place of Origin:CHINA

    5mg GHRP-6 Peptide Steroid Hormones GHRP For Muscle Growth Injectable Peptide

  •  Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder Manufactures
    ...Human Growth Peptide Hormone Injection Selank Raw Powder for Bodybuilding Quick detail Chemical Name : Selank Selank CAS Number : 129954-34-3 Selank Molecular Formula : C33H57N11O9 Selank ... more
    Brand Name:purity
    Model Number:129954-34-3
    Place of Origin:china

    Human Growth Peptides Bodybuilding Hormone Injection Selank Raw Powder

  •  Enhanced Bone Injectable Peptides Bodybuilding Improved Cholesterol Levels Manufactures
    ...Reship China Wholesale Buy Somatropin Humafactory bodybuilding 2iu 6iu 10iu 15iu Product Details: HGH PEN WATER BASE Genotropin pen 16iu/vials Genotropin ... more
    Brand Name:YIHAN
    Model Number:HGH 2iu
    Place of Origin:China

    Enhanced Bone Injectable Peptides Bodybuilding Improved Cholesterol Levels

    Yihan Industrial Co.,Ltd.
    [Guangdong,China]
  •  Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Without Negative Side Effects170851-70-4 Manufactures
    ...Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Basic Info Min. Order:10 vials Port:hongkong ... more
    Brand Name:wumeitech
    Model Number:CAS 77591-33-4 Pure Lab Peptides Thymosin Beta 4 /Tb500/Tb-500 Basic Info Port:China Production Capacity:50000pieces/Year Payment Terms: T/T,Western Union, Money Gram Model NO.: 77591-33-4 Customized: Customized Suitable for: Adult Purity: >97% Appearanc
    Place of Origin:China

    Injectable Peptide Hormones Ipamorelin 2mg/Vial for Muscle Growth Without Negative Side Effects170851-70-4

  •  High Purity 98% Peptides Steroids Trenbolone Acetate Powder CAS 10161-34-9 Manufactures
    Steroid hormone Yellow Crystalline Raw Steroid Powders Trenbolone Acetate CAS 10161-34-9 High Purity 98% Quick Details: Product name: Trenbolone Acetate Alias: Revalor-H; Finaplix; 17-beta-acetoxy-delta-4,9,11-estratrien-3-one; Tren A, Finajet CAS No: ... more
    Brand Name:Rund
    Model Number:10161-34-9
    Place of Origin:China

    High Purity 98% Peptides Steroids Trenbolone Acetate Powder CAS 10161-34-9

  •  CAS 121062-08-6 Melanotan II peptide Manufactures
    ....180 Purity : 98% Appearance : White Powder Specification:10mg/vial Grade : Pharmaceutical Grade Many in the bodybuilding community have already heard of Melanotan II (M2) and its amazing ability to promote darker... more
    Brand Name:YC
    Place of Origin:china
    Certification:ISO9001

    CAS 121062-08-6 Melanotan II peptide

  •  99% Purity Ibutamoren Mk 677 Sarms Powder CAS159752-10-0 For Bodybuilding China Wholesale Cheap Price Manufactures
    ...99% Purity Ibutamoren Mk 677 Sarms Powder CAS159752-10-0 For Bodybuilding China Wholesale Cheap Price Description: Basic Info Synonyms: Ibutamoren;2-Amino-N-[(1R)-2-[1,2-dihydro-1-(methylsulfonyl)spiro[3H-... more
    Brand Name:Datu Bio
    Model Number:Ibutamoren Mk 677 Sarms Powder
    Place of Origin:China

    99% Purity Ibutamoren Mk 677 Sarms Powder CAS159752-10-0 For Bodybuilding China Wholesale Cheap Price

  •  99% High Purity Raw Powder CAS 863288-34-0 CJC-1295 Acetate Manufactures
    ... point: 240 °C Assay: 99% min Grade: Pharmaceutical Grade CJC-1295 Effect CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH),it is beneficial to athletes... more
    Brand Name:Fuluobiotech
    Model Number:CAS863288-34-0
    Place of Origin:zhejiang

    99% High Purity Raw Powder CAS 863288-34-0 CJC-1295 Acetate

Tell “injectable peptides bodybuilding” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0